arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning asian bargain beef cheese dessert lamb pork poultry seafood tip top-10 vegetarian venison
Produktbild von Riesling
  • FRIED

2018er Riesling halbtrocken Rebgut FRIED Baumgärtner

Hohenhaslacher Kirchberg

  • Wein - weiß

Beschreibung

In der Nase zeigen sich Aromen von Grapefruit und
Limette, Ananas schwingt mit, ebenfalls krautige Noten

Der Mund ist erfüllt vom Geschmack reifen Steinobstes
und Südfrüchten. Obwohl die Süße dominiert, zeigt sich die
Säure präsent und lebendig

Produktinformationen

Flaschengröße 0,75 l
Verschluss Schraubverschluss
Qualitätsstufe Deutscher Qualitätswein
Herkunft Württemberg (Deutschland)
Alkoholgehalt 12,5% vol
Restsüße 17,4 g/l
Säuregehalt 7,0 g/l
Empfohlene Trinktemperatur von 8,0 bis 11,0 °C
Enthält Sulfite Ja
Enthält Ei-Allergene Enthält Ei-Protein
Enthält Milch-Allergene Nein
Gärung Tankgärung
Ausbau Edelstahltank (4 Monate)
GTIN 4260029870077

5,90€ 7,87€/Liter
inkl. Mwst. (zzgl. Versandkosten)

Produkte werden in 3 – 5 Werktagen geliefert.

Schmeckt zu

  • Asiatischer Küche
  • Geflügel

Zertifikate und Mitgliedschaften

Winzer

  • Friedrich Baumgärtner

  • Deutschland / Württemberg

  • Freudentaler Straße 32, 74343 Sachsenheim-Hohenhaslach

Informationen zum Shop von Rebgut FRIED Baumgärtner