arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning asian bargain beef cheese dessert lamb pork poultry seafood tip top-10 vegetarian venison
Produktbild von Cuveé Weiß - Eine Gute Flasche Wein 2016

Cuveé Weiß - Eine Gute Flasche Wein 2016 trocken Wein.gut Via Eberle

  • Wein - weiß

Beschreibung

Einer der drei Basis-Cuveés aus unserem Basissegment. Fruchtig - Spritzig - Trocken. Eine Gute Flasche Wein!

Produktinformationen

Rebsorte(n) Müller-Thurgau, Kerner
Flaschengröße 0,75 l
Verschluss Schraubverschluss
Qualitätsstufe Deutscher Qualitätswein
Herkunft Pfalz (Deutschland)
Alkoholgehalt 12,5% vol
Restsüße 4,6 g/l
Säuregehalt 6,8 g/l
Empfohlene Trinktemperatur von 4,0 bis 8,0 °C
Enthält Sulfite Ja
Enthält Ei-Allergene Enthält Ei-Protein
Enthält Milch-Allergene Nein
Gärung Edelstahltank (2 Monate)
Ausbau Edelstahltank (3 Monate)

5,50€ 7,33€/Liter
inkl. Mwst. (zzgl. Versandkosten)

Produkte werden in 3 – 5 Werktagen geliefert.

Schmeckt zu

  • Vegetarisches
  • Fisch und Meeresfrüchte
  • Geflügel

Winzer

  • Hubert Eberle

  • Deutschland / Pfalz

  • Schlachthofstraße 17, 67269 Grünstadt

Informationen zum Shop von Wein.gut Via Eberle