arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning
Logo von Weingut Thomas-Rüb
  • Wolfgang Rüb

  • Deutschland / Rheinhessen

  • 18,0 Hektar

  • Versand- und Zahlungsinformationen

Allgemeine Geschäftsbedingungen von Weingut Thomas-Rüb

Allgemeine Geschäftsbedingungen 


§ 1 Allgemeines, Geltungsbereich


Die nachstehenden Bedingungen gelten für alle Angebote, Lieferungen und Leistungen der Firma Weingut Thomas-Rüb GbR, Wilhelm-Leuschner Str. 29, 55237 Flonheim (nachfolgend Verkäufer genannt), auf der Domain


Verbraucher ist jede natürliche Person, die ein Rechtsgeschäft zu Zwecken abschließt, die überwiegend weder ihrer gewerblichen noch ihrer selbständigen beruflichen Tätigkeit zugerechnet werden können. Unternehmer sind dagegen jede natürliche oder juristische Personen oder eine rechtsfähige Personengesellschaft, die bei Abschluss eines Rechtsgeschäfts in Ausübung ihrer selbständigen beruflichen oder gewerblichen Tätigkeit handelt


Die Bestellabwicklung und Kontaktaufnahme finden auch per E-Mail und automatisierter Bestellabwicklung statt. Der Kunde hat sicherzustellen, dass die von ihm angegebene E-Mail-Adresse korrekt ist, so dass unter dieser Adresse die vom Verkäufer versandten E-Mails empfangen werden können. Beim Einsatz  von SPAM-Filtern ist sicherzustellen, dass alle vom Verkäufer oder von diesem mit der Bestellabwicklung beauftragten Dritten versandten Mails zugestellt werden können.


§ 2 Angebote, Auftragsbestätigung, Zustandekommen des Vertrages

2.1 .

Der Kunde kann ein verbindliches Kaufangebot (Bestellung) über das Online-Warenkorbsystem abgeben. Dabei werden die zum Kauf beabsichtigten Waren in einem virtuellen abgelegt. Über die entsprechende Schaltfläche in der Navigationsleiste kann der „Warenkorb" aufgerufen und Zusammensetzung verändert werden. Wenn der Kunde mit der Warenkorbzusammensetzung zufrieden ist, kann er im Bestellprozess fortfahren. Nach Eingabe der persönlichen Daten sowie der Zahlungs- und Versandbedingungen werden abschließend nochmals alle Bestelldaten auf einer Übersichtsseite angezeigt.


Soweit Sie das - ggfs. angebotene - Sofortzahl-System „PayPal – Express“ durch Anklicken der im Shopsystem integrierten entsprechend bezeichneten Schaltfläche nutzen, werden Sie auf die Log-In Seite von PayPal weitergeleitet. Nach erfolgreicher Anmeldung werden Ihre bei PayPal hinterlegten Adress- und Kontodaten angezeigt. Nach Bestätigung der Daten  auf der PayPal Seite werden Sie zurück in unseren Onlineshop auf die Bestellübersichtsseite geleitet.


Vor Absenden der Bestellung haben Sie die Möglichkeit, sämtliche Angaben nochmals zu überprüfen, zu ändern (auch über die Funktion „zurück" des Internetbrowsers) bzw. den Kauf abzubrechen.

Mit dem Absenden der Bestellung über die Schaltfläche "zahlungspflichtig bestellen" geben Sie ein verbindliches Angebot bei uns ab.



Ihre Bestellung über unseren o.g. Internet-Shop stellt jeweils ein Angebot an uns zum  Abschluss eines Kaufvertrages dar. Ein Kaufvertrag kommt erst dann zustande, wenn wir Ihre Bestellung, z.B. durch die Übersendung unserer Rechnung, als angenommen bestätigen oder ihr durch Übersendung der Ware nachkommen. Nach Ablauf von 2 Kalendertagen, gerechnet ab dem Tage, der dem Zugangstag des Kundenangebotes bei uns folgt, ist der Kunde an sein Angebot nicht mehr gebunden, wenn sein Angebot bis dahin nicht von uns angenommen worden ist.



Der Vertragstext wird vom Verkäufer nicht gespeichert und kann nach Abschluss des Bestellvorgangs nicht mehr abgerufen werden. Der Kunde kann die Bestelldaten aber unmittelbar vor dem Abschicken durch die Druckfunktion seines Browsers ausdrucken und erhält nach der Bestellung eine E-Mail, in welcher die Bestellung des Kunden nochmals aufgeführt wird. 


Die Bestellabwicklung und Kontaktaufnahme finden per E-Mail und automatisierter Bestellabwicklung statt. Der Kunde hat sicherzustellen, dass die von ihm angegebene E-Mail-Adresse korrekt ist, so dass unter dieser Adresse die vom Verkäufer versandten E-Mails empfangen werden können. Beim Einsatz  von SPAM-Filtern ist sicherzustellen, dass alle vom Verkäufer oder von diesem mit der Bestellabwicklung beauftragten Dritten versandten Mails zugestellt werden können.


§ 3 Preise

Alle Preise verstehen sich in Euro und enthalten die gesetzliche Umsatzsteuer und verstehen sich zuzüglich Versand- und Verpackungskosten. 


§ 4 Lieferung


Die Lieferung erfolgt durch Sendung der Ware ab Lager an die vom Kunden mitgeteilte Adresse. 



Die Lieferung erfolgt gegen die in der Internetbestellung angegebenen Verpackungs- und Versandkosten. Wenn der Kunde eine spezielle Art der Versendung wünscht, bei der höhere Kosten anfallen, so hat er auch diese Mehrkosten zu tragen.



Befindet sich der Kunde mit der Annahme der Ware in Verzug, hat er die Kosten einer erneuten Anlieferung zu tragen, soweit die erfolglose erste Anlieferung vom Kunden zu vertreten ist und er nicht von seinem Widerrufsrecht Gebrauch gemacht.



Teillieferungen sind nur dann zulässig, soweit diese dem Kunden zumutbar sind oder der Kunde ausdrücklich zugestimmt hat. Unzumutbar sind z.B. Teillieferungen eines einheitlichen Kaufgegenstandes. Teillieferungen haben keinerlei Einfluss auf die Rechte des Kunden aufgrund von Leistungsstörungen.


§ 5 Zahlungen


Sofern in den Angeboten nichts anderes bestimmt ist, können Sie wie folgt zahlen:


- per PayPal

- per Überweisung

- Nachnahme


Ist Vorauskasse vereinbart, ist die Zahlung sofort nach Vertragsabschluss fällig. 



Der Kunde kann ein Zurückbehaltungsrecht nur ausüben, soweit es sich um Forderungen aus demselben Vertragsverhältnis handelt.


§ 6 Widerrufsrecht bei Fernabsatzverträgen für Verbraucher

Verbrauchern steht ein Widerrufsrecht nach folgender Maßgabe zu, wobei Verbraucher jede natürliche Person ist, die ein Rechtsgeschäft zu einem Zwecke abschließt, der weder ihrer gewerblichen noch ihrer selbständigen beruflichen Tätigkeit zugerechnet werden kann: 

 Verbraucher ist jede natürliche Person, die ein Rechtsgeschäft zu Zwecken abschließt, die überwiegend weder ihrer gewerblichen noch ihrer selbständigen beruflichen Tätigkeit zugerechnet werden können. 




Sie haben das Recht, binnen vierzehn Tagen ohne Angabe von Gründen diesen Vertrag zu widerrufen. Die Widerrufsfrist beträgt vierzehn Tage ab dem Tag, an dem Sie oder ein von Ihnen benannter Dritter, der nicht der Beförderer ist, die Waren in Besitz genommen haben bzw. hat. Um Ihr Widerrufsrecht auszuüben, müssen Sie uns 


Weingut Thomas-Rüb GbR, Wilhelm-Leuschner-Str. 29, 55237 Flonheim, Fax 06734/962560, Tel 06734/1886 


mittels einer eindeutigen Erklärung (z.B. ein mit der Post versandter Brief, Telefax oder E-Mail) über Ihren Entschluss, diesen Vertrag zu widerrufen, informieren. Sie können dafür das beigefügte Muster-Widerrufsformular verwenden, das jedoch nicht vorgeschrieben ist. Zur Wahrung der Widerrufsfrist reicht es aus, dass Sie die Mitteilung über die Ausübung des Widerrufsrechts vor Ablauf der Widerrufsfrist absenden. 


Folgen des Widerrufs


Wenn Sie diesen Vertrag widerrufen, haben wir Ihnen alle Zahlungen, die wir von Ihnen erhalten haben, einschließlich der Lieferkosten (mit Ausnahme der zusätzlichen Kosten, die sich daraus ergeben, dass Sie eine andere Art der Lieferung als die von uns angebotene, günstigste Standardlieferung gewählt haben), unverzüglich und spätestens binnen vierzehn Tagen ab dem Tag zurückzuzahlen, an dem die Mitteilung über Ihren Widerruf dieses Vertrags bei uns eingegangen ist. Für diese Rückzahlung verwenden wir dasselbe Zahlungsmittel, das Sie bei der ursprünglichen Transaktion eingesetzt haben, es sei denn, mit Ihnen wurde ausdrücklich etwas anderes vereinbart; in keinem Fall werden Ihnen wegen dieser Rückzahlung Entgelte berechnet. Wir können die Rückzahlung verweigern, bis wir die Waren wieder zurückerhalten haben oder bis Sie den Nachweis erbracht haben, dass Sie die Waren zurückgesandt haben, je nachdem, welches der frühere Zeitpunkt ist. Sie haben die Waren unverzüglich und in jedem Fall spätestens binnen vierzehn Tagen ab dem Tag, an dem Sie uns über den Widerruf dieses Vertrags unterrichten, an uns zurückzusenden oder zu übergeben. Die Frist ist gewahrt, wenn Sie die Waren vor Ablauf der Frist von vierzehn Tagen absenden. Sie tragen die unmittelbaren Kosten der Rücksendung der Waren. Sie müssen für einen etwaigen Wertverlust der Waren nur aufkommen, wenn dieser Wertverlust auf einen zur Prüfung der Beschaffenheit, Eigenschaften und Funktionsweise der Waren nicht notwendigen Umgang mit ihnen zurückzuführen ist. 


Ausschluss bzw. vorzeitiges Erlöschen des Widerrufsrechts 


Das Widerrufsrecht besteht nicht bei Verträgen 


- zur Lieferung von Waren, die nicht vorgefertigt sind und für deren Herstellung eine individuelle Auswahl oder Bestimmung durch den Verbraucher maßgeblich ist oder die eindeutig auf die persönlichen Bedürfnisse des Verbrauchers zugeschnitten sind; - zur Lieferung von Waren, die schnell verderben können oder deren Verfallsdatum schnell überschritten würde; 


- zur Lieferung alkoholischer Getränke, deren Preis bei Vertragsschluss vereinbart wurde, die aber frühestens 30 Tage nach Vertragsschluss geliefert werden können und deren aktueller Wert von Schwankungen auf dem Markt abhängt, auf die der Unternehmer keinen Einfluss hat;


- zur Lieferung von Zeitungen, Zeitschriften oder Illustrierten mit Ausnahme von Abonnement-Verträgen. 


Das Widerrufsrecht erlischt vorzeitig bei Verträgen 


- zur Lieferung versiegelter Waren, die aus Gründen des Gesundheitsschutzes oder der Hygiene nicht zur Rückgabe geeignet sind, wenn ihre Versiegelung nach der Lieferung entfernt wurde; 


- zur Lieferung von Waren, wenn diese nach der Lieferung auf Grund ihrer Beschaffenheit untrennbar mit anderen Gütern vermischt wurden; 


- zur Lieferung von Ton- oder Videoaufnahmen oder Computersoftware in einer versiegelten Packung, wenn die Versiegelung nach der Lieferung entfernt wurde. 


Ende der Widerrufsbelehrung 


Bitte über die Druckfunktion ausdrucken und an der gepunkteten Linie abschneiden und das Formular ausgefüllt und unterschrieben an uns senden. ........................................................................................................................................




Wenn Sie den Vertrag widerrufen wollen, füllen Sie bitte dieses Formular aus und senden Sie es zurück. 


1.An Weingut Thomas-Rüb GbR, Wilhelm-Leuschner-Str. 29, 55237 Flonheim Tel. 06734/1886, Fax 06734/962560 



2. Hiermit widerrufe(n) ich/wir den von mir/uns abgeschlossenen Vertrag über den Kauf der folgenden Waren / die Erbringung der folgenden Dienstleistung: 




3. Bestellt am: ......................... 


4. Erhalten am: …………………..


5. (Name, Anschrift des Verbrauchers) 


6. Datum 



§ 7



§ 8 Gesetzliche Mängelhaftung


Wenn der Kunde als Verbraucher gekauft hat, verjähren seine Mängelhaftungsansprüche im Falle von Mängeln beim Kauf neuer Sachen innerhalb von zwei Jahren, beim Kauf gebrauchter Sachen innerhalb eines Jahres ab Gefahrenübergang. Von dieser Regelung ausgenommen sind Ansprüche wegen Mängeln, wenn der Verwender diese arglistig verschwiegen hat, und Ansprüche aus einer Garantie, die der Verwender für die Beschaffenheit der Sache übernommen hat. Für diese ausgenommenen Ansprüche gelten die gesetzlichen Verjährungsfristen. 



Wenn der Kunde als Unternehmer gekauft hat, verjähren seine Mängelhaftungsansprüche im Falle von Mängeln beim Kauf neuer Sachen innerhalb eines Jahres ab Gefahrübergang. Mängelansprüche beim Kauf gebrauchter Sachen bestehen nicht. Von dieser Regelung ausgenommen sind Ansprüche wegen Mängeln, wenn der Verwender diese arglistig verschwiegen hat, und Ansprüche aus einer Garantie, die der Verwender für die Beschaffenheit der Sache übernommen hat. Diesbezüglich gelten die gesetzlichen Verjährungsfristen. Die gelieferten Gegenstände sind unverzüglich nach Ablieferung an den Auftraggeber oder an den von ihm bestimmten Dritten sorgfältig zu untersuchen. Sie gelten als genehmigt, wenn dem Verkäufer nicht eine schriftliche Mängelrüge hinsichtlich offensichtlich er Mängel oder anderer Mängel, die bei einer unverzüglichen, sorgfältigen Untersuchung erkennbar waren, binnen sieben Werktagen nach Ablieferung des Liefergegenstandes oder ansonsten binnen sieben Werktagen nach der Entdeckung des Mangels zugegangen ist. Im Übrigen gelten die gesetzlichen Vorschriften



Hinsichtlich der Haftung wird auf die gesetzlichen Regelungen verwiesen.


§ 9 Datenschutz

Unsere Hinweise zum Datenschutz entnehmen Sie bitte der Datenschutzerklärung.


§ 10 Sonstiges

Sollten eine oder mehrere der vorstehenden Bedingungen unwirksam sein oder werden oder eine Lücke enthalten, bleiben die übrigen Bedingungen hiervon unberührt, sofern ein Festhalten an dem Vertrag für den Käufer nicht eine unzumutbare Härte darstellen würde (§ 306 BGB). Alleiniger Gerichtsstand für alle Streitigkeiten aus dem Vertragsverhältnis sowie über seine Wirksamkeit ist, wenn Sie Vollkaufmann, juristische Person des öffentlichen Rechts oder ein öffentlich rechtliches Sondervermögen sind oder Ihren Sitz im Ausland haben, unser Geschäftssitz. Für dieses Vertragsverhältnis gilt ausschließlich das Recht der Bundesrepublik Deutschland. Die Geltung des UN-Kaufrechts für den internationalen Kauf von Waren ist ausdrücklich ausgeschlossen. Vertragssprache ist deutsch.


Informationen zur Online-Streitbeilegung: Die EU-Kommission stellt eine Internetplattform zur Online-Beilegung von Streitigkeiten (sog. "OS-Plattform") bereit. 


Die OS-Plattform soll als Anlaufstelle zur außergerichtlichen Beilegung von Streitigkeiten betreffend vertragliche Verpflichtungen, die aus Online-Kaufverträgen erwachsen, dienen. 

 Die OS-Plattform ist unter folgendem Link erreichbar:

Unsere Mailadresse lautet:


Hinweis auf Beteiligung am Befreiungssystem der Landbell AG

Hinsichtlich der von uns erstmals mit Ware befüllten und an private Endverbraucher abgegebene Verkaufsverpackungen hat sich unser Weingut zur Sicherstellung der Erfüllung unserer gesetzlichen Pflichten nach § 6 VerpackV dem bundesweittätigen Rücknahmesystem der Landbell AG, Mainz,

(Kundennummer: 4134214) angeschlossen. Weitere Informationen finden Sie unter