arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning
Logo von Weingut Rinke - Grünhäuser Mühle
Profilbild von Weingut Rinke - Grünhäuser Mühle
  • Familie Marion und Alexander Rinke

  • Deutschland / Mosel

  • 4,4 Hektar

  • Versand- und Zahlungsinformationen

Mitgliedschaften

Weingut Rinke - Grünhäuser Mühle

Rinke Weine

Im Jahr 2006 haben wir als Quereinsteiger eine zusammenhängende Parzelle von ca. 3 ha an der Südlichen Weinmosel in Langsur, unmittelbar vor der Iuxemburgischen Grenze erworben.

Es handelt sich um die einzigartige Terrassenlandschaft des Langsurer Brüderbergs, eine alte, vergessene Grand Cru Lage mit einer Steigung zwischen 50 und 70 Grad. Das Areal bestehend aus Muschelkalkboden, das wie geschaffen für die Erzeugung großer Burgunder-Weine ist. Die Fläche, die vormals in kleine Einzelparzellen zerklüftet und verwildert oder mit Elbling bepflanzt war, wurde von uns komplett gerodet und überwiegend mit ertragsarmen burgundischen Chardonnay-Klonen, sowie etwas Pinot Blanc, Grauburgunder, Traminer, Muskateller und Viognier bepflanzt.

 Die verschiedenen Rebsorten stehen im Weinberg in zufälliger Anordnung und werden zusammen geerntet und ausgebaut (in Österreich wird dieses Verfahren als “Gemischter Satz” bezeichnet). Im Gegensatz zur Cuvée, die ein Verschnitt fertig vergorener Weine ist, handelt es sich hierbei um eine natürliche Cuvée, die im Weinberg entsteht. Mit der Neubepflanzung des Langsurer Brüderberges waren wir die Ersten, die dieses Verfahren, das im 19. Jahrhundert noch sehr gebräuchlich war, an der Mosel wiederbelebt haben. Ein “Gemischter Satz” zeichnet sich aufgrund der unterschiedlichen Reifegrade der beteiligten Rebsorten durch Vielschichtigkeit und aromatische Komplexität aus. Da sich Österreich die Bezeichnung “Gemischter Satz” schützen ließ, bezeichnen wir diese Verfahrensweise als “Mischsatz”.

In den letzten Jahren haben wir die Rebfläche im Langsurer Brüderberg durch Pinot Noir ergänzt. Auch beim Pinot Noir setzen wir auschließlich auf burgundische Klone mit geringem Ertragsansatz.

Seit 2015 bewirtschaften wir auch einige Parzellen in bester Steillage an der Saar (Oberemmeler Altenberg, Wiltinger Klosterberg und Wiltinger Braunfels). Diese Weinberge sind mit Riesling, dem sehr seltenen Pinot Noir Précoce (Frühburgunder) und Pinot Noir bepflanzt. Es handelt sich ausschließlich um Schiefer-Steil- und Steilstlagen, die zum größten Teil noch in Einzelpfahlerziehung stehen. Unsere Rieslingweinberge an der Saar sind im Durchschnitt 50 Jahre alt (“Alte Reben”). Unsere Rieslinge aus Alten Reben zeichnen sich durch niedrigen Ertrag, Dichte und Vielschichtigkeit aus.

Im Weinberg arbeiten wir naturnah, ohne mineralische Dünger und Herbizide. Die Begrünung zwischen den Rebzeilen ist natürlich und nicht eingesät. Auch im Weinberg verfolgen wir den „Weniger ist Mehr“ Ansatz. Die intensive Kräuternote in all unseren Weinen ist unser minimalistischen Weinbergsbearbeitung geschuldet.

Bild 1 von Weingut Rinke - Grünhäuser Mühle auf Euvino.eu
Bild 2 von Weingut Rinke - Grünhäuser Mühle auf Euvino.eu
Bild 3 von Weingut Rinke - Grünhäuser Mühle auf Euvino.eu
Bild 4 von Weingut Rinke - Grünhäuser Mühle auf Euvino.eu
Bild 5 von Weingut Rinke - Grünhäuser Mühle auf Euvino.eu
Bild 6 von Weingut Rinke - Grünhäuser Mühle auf Euvino.eu
Bild 7 von Weingut Rinke - Grünhäuser Mühle auf Euvino.eu
Bild 8 von Weingut Rinke - Grünhäuser Mühle auf Euvino.eu
Bild 9 von Weingut Rinke - Grünhäuser Mühle auf Euvino.eu

Philosophie in Weinberg und Keller 

Alle Trauben werden zum optimalen Lesezeitpunkt selektiv von Hand gelesen. Bei den Weißweinen setzen wir komplett auf Spontanvergärung (kein Zusatz von Reinzuchthefen). Bei der Spontanvergärung wandeln die natürlicherweise auf den Beerenschalen vorkommenden Hefen den Traubenzucker in Alkohol um. Wir glauben, dass spontan vergorene Weine eine größere Komplexität und mehr mineralische Aromen aufweisen. Auch der Lagencharakter tritt bei Spontanvergärung deutlicher hervor. Der Weinausbau erfolgt ausschließlich in Holzfässern. Enzyme, Klärhilfen und Eiweißstabilisatoren finden bei uns keinen Einsatz. Wir entsäuern und chaptalisieren sind. Alle unsere Weine sind vegan. Wir stehen für Weine mit jahrgangstypischer Persönlichkeit, die ihre große Lage zum Ausdruck bringen, nicht für im Keller “gemachte”, austauschbare Weine. Unsere Weine benötigen nach der Füllung oft noch Zeit, bis sie sich öffnen. Sie sind eher nicht für den schnellen Konsum gemacht und zeichnen sich durch Langlebigkeit aus. 

Unsere Weine

Unsere Burgunderweine aus dem Langsurer Brüderberg (Südliche Weinmosel)Die Weißweine aus der Lage Langsurer Brüderberg bestehen zu ca. 90 % aus Chardonnay und zu 10% aus anderen Burgundersorten (Pinot Blanc, Pinot Gris, Viognier, Traminer, Muskateller). Bei den Chardonnayreben handelt es sich überwiegend um unterschiedliche klassische Klone alter Genetik („Séléction Massale”) - Herkünfte mit sehr niedrigem Ertragsansatz - auf schwachwüchsigen Unterlagswurzeln.

Im Langsurer Brüderberg bauen wir Chardonnay mit den vorgenannten Burgundersorten zusammen an, ernten die unterschiedlichen Rebsorten gemeinsam und bauen sie zusammen aus (“Mischsatz”). Dadurch erziehlen wir Weine von großer Komplexität, die eine gewisse Exotik aufweisen.

Ausgebaut werden unsere Chardonnay Mischsätze von Gernot Kollmann, der uns auch beim Erwerb und der Neubestockung des Langsurer Brüderberges beraten hat.

Wir bauen unsere Chardonnay Mischsätze aus dem Langsurer Brüderberg in zwei Linien aus. Den Einstieg bildet der Langsurer Brüderberg Muschelkalk aus dem unteren Bereich des Weinberges (bis ca. 50% Steigung).

Unser Top-Erzeugnis bildet der Langsurer Brüderberg Terrassen S, dessen Lesegut aus den weiter oben gelegenen Terrassen des Langsurer Brüderbergs stammt (bis zu 75% Steigung). Der Langsurer Brüderberg Terrassen S Chardonnay Mischsatz wird in kleinen Barriquefässern ausgebaut und im September des Folgejahres nach der Ernte abgefüllt. Wir benutzen für den Ausbau bewusst gebrauchte Barriques, da wir lediglich eine zarte, gut eingebundene Holznote anstreben, jedoch keinen vom Holz dominierten Wein.

2013 haben wir erstmals einen Pinot Noir aus dem Langsurer Brüderberg geerntet. Auch beim Rotwein liefert der Muschelkalkboden des Langsurer Brüderberges in Verbindung mit den burgundischen Pinot Noir Klonen hoch mineralische Weine, mit feinen und eleganten Fruchtaromen.

Die Weine von der Saar

Unsere Weinberge an der Saar im Oberemmeler Altenberg, Wiltinger Klosterberg und Wiltinger Braunfels sind mit Riesling, Pinot Noir und dem sehr seltenen Pinot Noir Précoce (Frühburgunder) bestockt. Es handelt sich um Schiefer-Steil- und Steilstlagen, zum größten Teil in Einzelpfahlerziehung. Unsere Rieslinganlagen an der Saar sind im Durchschnitt 50 Jahre alt (“Alte Reben”).

Informationen zum Shop von Weingut Rinke - Grünhäuser Mühle