arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning
Logo von Weingut Martin Schropp
  • Martin Schropp

  • Deutschland / Württemberg

  • 13,0 Hektar

  • Versand- und Zahlungsinformationen

Datenschutzerklärung von Weingut Martin Schropp

Jeder Zugriff auf unsere Internetseiten sowie jeder Abruf einer Seite und/oder Datei im Rahmen des Internet-Auftritts werden protokolliert. Die Speicherung dient ausschließlich statistischen Zwecken. Protokolliert werden: Name der abgerufenen Datei/Seite, Datum und Uhrzeit des Abrufs, übertragene Datenmenge, Meldung über erfolgreichen Abruf, Webbrowser und anfragende Domain. Zusätzlich werden die IP-Adressen der anfragenden Rechner protokolliert. Weitergehende personenbezogene Daten werden nur erfasst und genutzt, wenn Sie diese Angaben freiwillig, etwa im Rahmen einer Anfrage oder Registrierung machen. Gleiches gilt für die Abonnierung eines Newsletters. Soweit Sie uns personenbezogene Daten zur Verfügung stellen, verwenden wir diese nur zur Bearbeitung Ihres Anliegens und ausschließlich zu dem jeweils vorgesehenen Zweck (Beispiel: Benutzung Ihrer E-Mail-Adresse zur Versendung eines von Ihnen abonnierten Newsletters). Personenbezogene Daten werden an Dritte nur weitergegeben oder sonst übermittelt, wenn dies zum Zwecke einer Vertragsabwicklung oder zu Abrechnungszwecken erforderlich ist oder Sie der Weitergabe/Übermittlung von Daten an Dritte zugestimmt haben. Sie haben das Recht, eine erteilte Einwilligung mit Wirkung für die Zukunft jederzeit, auch formlos (z.B. per Email) zu widerrufen. Die Löschung der gespeicherten personenbezogenen Daten erfolgt, wenn Sie Ihre Einwilligung zur Speicherung widerrufen, wenn ihre Kenntnis zur Erfüllung des mit der Speicherung verfolgten Zwecks nicht mehr erforderlich ist oder wenn ihre Speicherung aus sonstigen gesetzlichen Gründen unzulässig ist. Auf schriftliche Anfrage werden wir Sie gern über die zu Ihrer Person gespeicherten Daten informieren. Weingut Martin Schropp Straßenäcker 1 74235 Erlenbach-Binswangen Telefon: 07132-7644 Inhaber und Verantwortlicher: Martin Schropp Erlenbach-Binswangen im Juli 2012