arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning
Logo von Weingut Manfred Braun
  • Manfred Braun

  • Deutschland / Franken

  • 4,0 Hektar

  • Versand- und Zahlungsinformationen

Datenschutzerklärung von Weingut Manfred Braun

Datenschutzerklärung Der Schutz Ihrer personenbezogenen Daten bei der Erhebung, Verarbeitung und Nutzung anlässlich Ihres Besuchs in unserem Webshop ist uns ein wichtiges Anliegen. Ihre Daten werden im Rahmen der gesetzlichen Vorschriften geschützt. Nachfolgend finden Sie Informationen, welche Daten während Ihres Besuches in unserem Webshop erfasst und wie diese genutzt werden: 1. Erhebung und Verarbeitung von Daten Jeder Zugriff auf unsere Homepage und jeder Abruf einer auf der Homepage hinterlegten Datei werden protokolliert. Die Speicherung dient internen, systembezogenen und statistischen Zwecken. Protokolliert werden: Name der abgerufenen Datei, Datum und Uhrzeit des Abrufs, übertragene Datenmenge, Meldung über erfolgreichen Abruf, Webbrowser und anfragende Domain. Zusätzlich werden die IP-Adressen der anfragenden Rechner protokolliert. Weitergehende personenbezogene Daten werden nur erfasst, wenn Sie diese Angaben freiwillig, etwa im Rahmen einer Anfrage, Bestellung oder Registrierung, machen. 2. Nutzung und Weitergabe personenbezogener Daten Soweit Sie uns personenbezogene Daten zur Verfügung gestellt haben, verwenden wir diese nur zur Beantwortung Ihrer Anfragen, zur Abwicklung mit Ihnen geschlossener Verträge und für die technische Administration. Ihre personenbezogenen Daten werden an Dritte nur weitergegeben oder sonst übermittelt, wenn dies zum Zwecke der Vertragsabwicklung - insbesondere Weitergabe von Bestelldaten an Lieferanten - erforderlich ist, dies zu Abrechnungszwecken erforderlich ist oder Sie zuvor eingewilligt haben. Sie haben das Recht, eine erteilte Einwilligung mit Wirkung für die Zukunft jederzeit zu widerrufen. Die Löschung der gespeicherten personenbezogenen Daten erfolgt, wenn Sie Ihre Einwilligung zur Speicherung widerrufen, wenn Ihre Kenntnis zur Erfüllung des mit der Speicherung verfolgten Zwecks nicht mehr erforderlich ist oder wenn Ihre Speicherung aus sonstigen gesetzlichen Gründen unzulässig ist. 3. Auskunftsrecht Auf schriftliche Anfrage werden wir Sie gerne über die zu Ihrer Person gespeicherten Daten informieren. Sicherheitshinweis: Wir sind bemüht, Ihre personenbezogenen Daten durch Ergreifung aller technischen und organisatorischen Möglichkeiten so zu speichern, dass sie für Dritte nicht zugänglich sind. Bei der Kommunikation per E-Mail kann die vollständige Datensicherheit von uns nicht gewährleistet werden, so dass wir Ihnen bei vertraulichen Informationen den Postweg empfehlen. Diese Website benutzt Google Analytics, einen Webanalysedienst der Google Inc. („Google“). Google Analytics verwendet sog. „Cookies“, Textdateien, die auf Ihrem Computer gespeichert werden und die eine Analyse der Benutzung der Website durch Sie ermöglichen. Die durch den Cookie erzeugten Informationen über Ihre Benutzung dieser Website (einschließlich Ihrer IP-Adresse) wird an einen Server von Google in den USA übertragen und dort gespeichert. Google wird diese Informationen benutzen, um Ihre Nutzung der Website auszuwerten, um Reports über die Websiteaktivitäten für die Websitebetreiber zusammenzustellen und um weitere mit der Websitenutzung und der Internetnutzung verbundene Dienstleistungen zu erbringen. Auch wird Google diese Informationen gegebenenfalls an Dritte übertragen, sofern dies gesetzlich vorgeschrieben oder soweit Dritte diese Daten im Auftrag von Google verarbeiten. Google wird in keinem Fall Ihre IP-Adresse mit anderen Daten von Google in Verbindung bringen. Sie können die Installation der Cookies durch eine entsprechende Einstellung Ihrer Browser Software verhindern; wir weisen Sie jedoch darauf hin, dass Sie in diesem Fall gegebenenfalls nicht sämtliche Funktionen dieser Website vollumfänglich nutzen können. Durch die Nutzung dieser Website erklären Sie sich mit der Bearbeitung der über Sie erhobenen Daten durch Google in der zuvor beschriebenen Art und Weise und zu dem zuvor benannten Zweck einverstanden