arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning asian bargain beef cheese dessert lamb pork poultry seafood tip top-10 vegetarian venison


Produktbild von Weißburgunder Kabinett feinherb
  • feinherb / halbtrocken

2018er Weißburgunder Kabinett feinherb Weingut Mathias Peter



  • Wein - weiß


feinfruchtiger und säure milder Weißwein, schöner Sommerwein


Flaschengröße 0,75 l
Verschluss Schraubverschluss
Qualitätsstufe Deutscher Prädikatswein - Kabinett
Herkunft Pfalz (Deutschland)
Alkoholgehalt 11,5% vol
Restsüße 15,7 g/l
Säuregehalt 7,6 g/l
Empfohlene Trinktemperatur von 8,0 bis 12,0 °C
Enthält Sulfite Ja
Enthält Ei-Allergene Enthält Ei-Protein
Enthält Milch-Allergene Enthält Milchprotein
Gärung Edelstahltank
Ausbau Edelstahltank (2 Monate)

6,40€ 8,53€/Liter
inkl. Mwst. (zzgl. Versandkosten)

Produkte werden in 3 – 5 Werktagen geliefert.

Schmeckt zu

  • Vegetarisches
  • Fisch und Meeresfrüchte
  • zum Dessert


  • Internationaler WeinGrandPrix Düsseldorf 2018 Gold
  • Silberne Kammerpreismünze

Zertifikate und Mitgliedschaften


  • Mathias Peter

  • Deutschland / Pfalz

  • Burgstraße 10 10, 67157 Wachenheim an der Deutschen Weinstraße

Informationen zum Shop von Weingut Mathias Peter