arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning
Logo von Weingut Eck
  • Jürgen Eck

  • Deutschland / Pfalz

  • 13,0 Hektar

  • Versand- und Zahlungsinformationen

Datenschutzerklärung von Weingut Eck

Der Schutz Ihrer personenbezogenen Daten bei der Erhebung, Verarbeitung und Nutzung anlässlich Ihres Besuchs auf unserer Webpräsenz ist uns ein wichtiges Anliegen. Ihre Daten werden im Rahmen der gesetzlichen Vorschriften geschützt. Nachfolgend finden Sie Informationen welche Daten während Ihres Besuchs auf der Webpräsenz erfasst und wie diese genutzt werden:

1. Erhebung und Verarbeitung von Daten
Jeder Zugriff auf unsere Webpräsenz und jeder Abruf einer dieser hinterlegten Datei werden protokolliert. Die Speicherung dient internen systembezogenen und statistischen Zwecken. Protokolliert werden: Name der abgerufenen Datei, Datum und Uhrzeit des Abrufs, übertragene Datenmenge, Meldung über erfolgreichen Abruf, Webbrowser und anfragende Domain. Zusätzlich werden IP Adressen der anfragenden Rechner protokolliert. Weitergehende personenbezogene Daten werden nur erfasst, wenn Sie diese Angabe freiwillig, etwas im Rahmen einer Anfrage oder Registrierung machen.

2. Nutzung und Weitergabe personenbezogener Daten
Soweit Sie uns personenbezogene Daten zur Verfügung gestellt haben, verwenden wir diese nur zur Beantwortung Ihrer Anfragen, zur Abwicklung mit Ihnen geschlossener Verträge und für die technische Administration.

Ihre personenbezogenen Daten werden an Dritte nur weitergegeben oder sonst übermittelt, wenn dies zum Zwecke der Vertragsabwicklung erforderlich ist, dies zu Abrechnungszwecken notwendig wird oder Sie zuvor eingewilligt haben. Sie haben das Recht, eine erteilte Einwilligung mit Wirkung für die Zukunft jederzeit zu widerrufen.

Die Löschung der gespeicherten Daten erfolgt, wenn Sie Ihre Einwilligung zur Speicherung widerrufen, deren Kenntnis zur Erfüllung des mit der Speicherung verfolgten Zwecks nicht mehr erforderlich ist oder deren Speicherung aus sonstigen Gründen unzulässig ist.

3. Auskunftsrecht
Auf schriftliche Anfrage informieren wir Sie gern über die zu Ihrer Person gespeicherten Daten.

Wir bemühen uns, Ihre personenbezogenen Daten durch entsprechende technische und organisatorische Möglichkeiten so zu speichern, dass die für Dritte nicht zugänglich sind. Bei einer Kommunikation per E-Mail kann die vollständige Datensicherheit von uns nicht gewährleistet werden, so dass wir Ihnen bei vertraulichen Informationen die Nutzung des Postweges empfehlen.

Die in der Internetpräsentation verwendeten Fotos zur Darstellung der Produkte wurden vom Weingut Eck erstellt.

Die vorliegenden Texte innerhalb der Präsentation zur Darstellung der Produkte wurden vom Weingut Eck erstellt.