arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning Farbenreichtum des Weines - Eine bunte Geschmackspalette

Farbenreichtum des Weines - Eine bunte Geschmackspalette

Wein gibt es in allen Farben des Regenbogens.

Okay, das war vielleicht gelogen, dennoch ist der Farbreichtum den die vielen Weinsorten erzeugen beeindruckend. Nicht nur aus ästhetischer Sicht sondern auch aus praktischer. Für den Konsum und den Genuss spielt die Farbe des Weins tatsächlich nur einer untergeordnete Rolle, aber für den Weinkenner gehört sie zum Gesamtwerk und verzerrt durchaus das Bild wenn es nicht dem Qualitätsstandard des Weines entspricht.

Also holen Sie sich Ihren liebsten Tropfen und malen ein Kunstwerk auf ihrem Gaumen

Die Weinpalette von Euvino

Weinfarbenverständnis

Bei der gezielten Degustation ist die Farbe dagegen ein wesentlicher, oftmals unterschätzter Indikator für Qualität, sind doch Entwicklung, Extraktion und Reifung der Aroma- und Farbstoffe eines Weins eng miteinander verknüpft. So lässt sich aus der Farbe auf die geschmackliche Konzentration, die Güte des Jahrgangs, auf Rebsorte, Machart und Alter schließen. Das setzt jedoch voraus, dass die Farbe auf natürliche Weise zustande gekommen ist, also nicht auf künstliche Farbverstärkung wie beispielsweise Additive oder Enzyme zurückgeht, die heute ohne allzu großen Aufwand auch einem Mittelklasse-Rotwein eine tiefdunkle, wenn nicht fast schwarze Farbe verleihen können.

Eine Farbe nicht nur nach ästhetischen Gesichtspunkten zu beurteilen setzt allerdings umfangreiche Kenntnisse der Weinchemie voraus. Lange Zeit wurde deshalb bei Verkostungen die Farbe zwar weiterhin betrachtet, jedoch nur selten als Qualitätsspiegel benutzt. Erst die Mode tiefdunkler, nahezu schwarzer Rotweine lenkte die Aufmerksamkeit wieder verstärkt auf das Erscheinungsbild eines Weins.


Wie kommt die Farbe in den Wein?

Alle Rotwein- und Weißweintrauben enthalten von Natur aus Farbpigmente. Diese sind je nach Reifegrad und Traubensorte heller oder dunkler, und weniger oder mehr in den Beerenhüllen konzentriert. Dieses Farbpotential eines Weins entsteht bereits im Hang. Ausgangsbasis ist dabei die Rebsorte. Dabei ist jedoch Pinot Noir nicht gleich Pinot Noir und Cabernet nicht gleich Cabernet, existieren doch die meistangebauten Rebsorten der Welt in verschiedenen Varietäten. Durch die Klonselektion zugunsten von Klein- und Großbeerigkeit, Niedrig- oder Hochertragspflanzen werden die Grundlagen zur Verbesserung von Qualität oder Quantität geschaffen und verschaffen so den Farben der Trauben ihre speziellen Nuancen.


Danach sind es Rebschnitt, Laubwerksarbeit und Düngung, die sich generell auf die Qualität und speziell immer auch auf die Farbe des Weins auswirken. Erst an dritter Stelle kommt dann die Arbeit im Weinkeller, wo das Farb- und damit auch das Aromapotential ausgeschöpft werden muss. Zu guter Letzt wird die Dauer und Art der Lagerung des Weins Spuren in seinem Erscheinungsbild hinterlassen. Und auch hier geht jede Farbveränderung mit geschmacklichem Wandel einher.


Einmal Wein Schranke, bitte. - Rotwein klar, aber Weißwein?

Weißwein wird häufig als Wein ohne Farbe bezeichnet, da er meist ohne Maischekontakt vinifiziert wird. Das stimmt nun nicht ganz. Die von blassgrün bis goldgelb reichende Farbe des Weißweines ist für das menschliche Auge nur schwerer zu erkennen, da ihr Farbspektrum großenteils im ultravioletten Bereich liegt. Normalerweise kommt es im Weißwein zu einer Mischung aus grünen und gelben Pflanzenfarbstoffen. Diese Phenole befinden sich nicht nur in den Schalen, sondern auch im Fruchtfleisch hellhäutiger Trauben. Deshalb enthalten Weißweine, deren Saft nicht auf den Schalen vergoren wurde, immer auch eine gewisse Menge an Farbpigmenten.

Das größte Farbpotential besitzen Trauben mit leicht purpurner oder grau rosa Färbung. Bei anderen Sorten sorgt eine abweichende chemische Zusammensetzung der Farbstoffe für grünliche Reflexe im Wein, dies kann aber auch durchaus am Glas liegen. Auch dieses Medium spielt in die Farbgestaltung des präsentierten Weines mit ein. Mit dem Beginn der Gärung werden die Farbstoffe physikalischen, chemischen und biologischen Einflüssen ausgesetzt, die mehr oder weniger deutliche Spuren im Wein hinterlassen.

Rot, die bekannteste Farbe unter den Weinen

Rotwein enthält im Durchschnitt zehnmal mehr Farbstoffe als Weißwein. Diese Anthocyane stammen ausschließlich aus der Beerenhülle, wo sie sich erst im Reifestadium der Traube bei direkter Sonneneinstrahlung entwickelt haben. Das Farbpotential eines Rotweins wird umso größer sein, je dicker und reifer die Schale der Beeren ist und je weniger Saft sie enthalten. Zudem wirken Tannine auf die Farbstoffe stabilisierend, weshalb tanninreiche Weine farbintensiver sind. Dickschalige Rebsorten wie Cabernet Sauvignon und Syrah liefern von Natur aus dunkle Rotweine, wohingegen bei dünnschaligeren Varietäten die Farbdichte geringer sein wird.

Eine optimale Arbeit im Weinberg vorausgesetzt, kann jedoch auch eine dünnschalige Sorte farbintensive Weine liefern, sofern ihr Ertrag niedrig gehalten und das Laub der Stöcke angemessen ausgelichtet wird. In der Kellerarbeit hängt die Farbextraktion dann ganz wesentlich davon ab, wie lange und bei welcher Temperatur der Traubensaft in Kontakt mit den eingemaischten Traubenschalen zusammen bleibt. Deshalb besteht durchaus die Gefahr der Überextraktion, die den Wein jeglicher Eleganz und Farbintensivität beraubt. Die farbenfrohesten Weine müssen also nicht grundsätzlich die Besten sein. Hinter einem blass-wässrigen Erscheinungsbild wird sich allerdings nur in seltenen Ausnahmefällen ein großartiger Wein verbergen.


Also greifen Sie zur nächsten Flasche und schmecken sie den Farbenreichtum der Winzer dieser Welt. Vielleicht finden Sie ja das Gold am Ende des Weinregenbogens.