arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning
Logo von Domaine Treloar
Profilbild von Domaine Treloar
  • Domaine Treloar

  • Frankreich / Languedoc-Roussillon

  • Versand- und Zahlungsinformationen

Domaine Treloar

Weingut Domaine Treloar - naturnaher Weinanbau

Das Weingut Domaine Treloar liegt in einer der interessantesten Weinanbauregion in Frankreich. Languedoc-Roussillon heißt die französische Region und diese liegt südwestlich von Perpignan im Ort Trouillas. Das Weingut Domaine Treloar wird von Rachel und Jonathan Hersford geführt. Die Inhaber des Weingutes beschlossen ihr Leben umzugestalten und sind von New Yourk ins Languedoc-Roussillon gezogen. Im Jahre 2006 haben Rachel und Jonathan ein 10 Hektar großes Weingut im südlichen Frankreich gekauft. Das Weingut liegt nahe der spanischen Grenze und besitzt einen historischen Hintergrund. Jonathan ist studierter Önologe und kannte sich schon vor dem Kauf des Weingutes Domaine Treloar mit Weinanbau aus. Den praktischen Weinanbau hat er sich bei einem renommierten Weingut in Neuseeland angeeignet.

Produkte im Shop

8 Ergebnisse
8 Ergebnisse

Domaine Treloar - ein Weingut in Handarbeit
Das Weingut Domain Treloar in der Languedoc-Roussillon wird von Rachel und Jonathan in Handarbeit geführt. Es wird ökologisch Bewirtschaftet. Das bedeutet, dass Bodenlockerung, Pflügen, Rebschnitt, Grünlese und Ernte ökologisch erfolgen. Auch die Laubentfernung wird unter ökologischen Gesichtspunkten durchgeführt. Es werden Rebsorten wie Syrah, Mourvedre, Carignan blanc, Muscat, Garnacha und Macabeu kultiviert und geerntet. Nicht nur die Weintraubenlese wird naturbelassen durchgeführt. Auch die Weiterverarbeitung erfolgt naturnah.

Languedoc-Roussillon - naturnahe Weinherstellung
Weinanbau und Weinlese werden ökologisch durchgeführt. Die Weiterverarbeitung erfolgt ebenfalls unter naturnahen Bedingungen. Dazu gehört nur minimale Schwefelzugabe, die lediglich an der Mindestgrenze liegt. Rachel und Jonathan verzichten auf den Zusatz künstlicher Substanzen wie Enzyme und Hefen. Der Wein soll überwiegend durch den natürlichen Bodensatz reifen. Der Wein soll mindestens 12 Monate, in der Regel sogar länger, in französischen Eichenfässern reifen. Vor der Abfüllung wird der Wein, meist zum ersten Mal, filtriert. Die Filterung erfolgt in der Regel grob. Durch die naturbelassene Weinproduktion wird der besondere Charakter der Weine und des Weinguts Domaine Treloar in Languedoc-Roussillon hervorgehoben. Die Weine zeichnen sich durch eine kraftvolle Intensität und durch eine aromatische Reinheit aus. Vielfältige Aromen werden Ihren Gaumen verwöhnen und Ihnen den Charakter des französischen Weingutes näher bringen. Die Weine des Weingutes Domaine Treloar werden mit hohen Bewertungen ausgezeichnet, wie beispielsweise von La Revue du Vin de France und von Jancis Robinson MW. Der Wein MO2 des Weingutes Domaine Treloar greift die Tradition des Rancio (katalanischer Wein) auf. Werfen Sie einen Blick auf Languedoc-Roussillon und das Weingut Domaine Treluar. Es kann sich für Weingourmets lohnen.

Informationen zum Shop von Euvino GmbH