arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning
Logo von Domaine de la Camarette
  • Familie Gontier

  • Frankreich / Rhône-Tal

  • 40,0 Hektar

  • Versand- und Zahlungsinformationen

Impressum von Domaine de la Camarette

CONDITIONS GENERALES DE VENTE ART. 1 : Toutes nos offres sont faites sans engagement de notre part. Elles n'engagent la S.C.E.A. LA CAMARETTE qu'après sa confirmation écrite. Elles ne valent que pour la quantité confirmée. ART. 2 : Toutes les conditions après confirmation sont basées sur les cotations (prix TTC, fret, etc. … ) actuellement en vigueur. En cas de variation d'un de ces éléments, elles subiront une adaptation corrélative même sans avis préalable. ART. 3 : Les dates de livraison que le vendeur s'efforce toujours de respecter sont toutefois données à titre indicatif. Il est entendu qu'elles ne peuvent en aucun cas engager le vendeur. En cas de retard, elles ne peuvent donner lieu à indemnité et ne peuvent constituer un motif de résiliation du contrat quelle que soit la cause de ce retard. ART. 4 : Si une erreur de désignation se produisait, elle donnerait lieu à un remplacement des produits sans autre indemnité, quelle que soit l'époque de sa contestation. De même, si certaines marchandises étaient reconnues défectueuses, notre responsabilité est de convention expresse limitée au remplacement. ART. 5 : Même expédiées en franco de port à l'adresse indiquée par l'acheteur, nos marchandises voyagent aux risques et périls des destinataires qui, en cas d'avarie, doivent faire toute réserve auprès du transporteur et, le cas échéant, exercer eux-mêmes tous recours auprès des sociétés de transport, quel que soit le mode d'expédition. ART. 6 : Toutes les marchandises sont reconnues au Domaine et départ cave. Nous déclinons toutes responsabilités en cas d'altération lors du transport ou de l'expédition. ART. 7 : En cas d'épuisement d'un millésime, nous nous engageons à livrer le millésime le plus approchant sans préavis de notre part. ART. 8 : Sauf convention particulière, nos factures sont payables au comptant. En cas de non respect des échéances convenues, les agios seront débités selon la loi. Nous acceptons le règlement des sommes dues par chèque libellé à notre nom et en notre qualité de Membre d'un Centre de Gestion Agréé par l'administration Fiscale. Pas d’escompte en cas de paiement comptant. ART. 9 : Le défaut de paiement à l'échéance fixée entraînera, sauf report accordé par nous, une intervention de notre contentieux. A titre de dommages et intérêts, outre les frais judiciaires et les intérêts légaux, une indemnité égale à 15% du montant de la dette sera exigée. Cette indemnité ne pourra en aucun cas être inférieure à 150 euros. ART. 10 : Nonobstant toutes ces clauses, il est expressément précisé que la fourniture entre dans le cadre de l'application de la loi N° 80 335 du 12.05.1980 relative à la réserve de propriété qui conditionne le transfert de propriété au paiement intégral du prix de la fourniture. ART. 11 : La juridiction d'Avignon, 84 000, est seule compétente pour connaître toutes contestations et ce quel que soit le lieu de livraison ou le mode de règlement adopté et nonobstant toutes clauses contraires même en cas d'appel en garantie ou de pluralité de défendeurs.