arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning
Logo von Domaine Clavel
Profilbild von Domaine Clavel
  • Pierre Clavel

  • Frankreich / Languedoc-Roussillon

  • Versand- und Zahlungsinformationen

Domaine Clavel

Pierre Clavel ist ein Mensch, der auch denjenigen eine Bereicherung ist, die des Französischen nicht mächtig sind. Seine Verschmitztheit, seine Nachdenklichkeit und Bescheidenheit dürften nur verstockten Zeitgenossen verborgen bleiben. Die Weinberge der Domaine, deren Charakteristik sich in den Clavel-Weinen widerspiegelt, liegen bis zu 30 km auseinander: Die Gegend um den 658 m hohen Pic Saint-Loup ist kühler und regnerischer, die Mejanelle heißer und trockener. „Eine andere Welt“, sagt Pierre, in dessen Weinkeller eigentlich immer Musik im Hintergrund läuft. Bei aller Bescheidenheit, man muss ja auch mal an sich denken…

Produkte im Shop

5 Ergebnisse
5 Ergebnisse
Das Weingut Domaine Clavel

Domain Clavel ist ein französisches Weingut und liegt im Languedoc. Die Weinberge umfassen ca. 25 Hektar und decken drei Weingebiete ab. Dazu gehören die Languedoc-Appellation Pic Saint Loup sowie Gres Montpellier Das Méjanelle. Die Inhaber betreiben ökologische Landwirtschaft und führen das Weingut mit Respekt vor der Natur. Das Weingut Domaine Clavel erfreut sich internationaler Beliebtheit und liefert rassige Weine in alle Welt.

Pierre Clavel - Winzersohn mit dem Gespür für gute Weine

Pierre Clavel startete seine Karriere mit viel Enthusiasmus und ersten Probenergebnissen, die ihm internationale Aufmerksamkeit verschafften. Er führte das Ergebnis seiner Arbeit auf das einzigartige Terrain zurück, in denen seine Anbaugebiete liegen. Ein weiteres Geheimnis des Erfolges des Weinguts Domaine Clavel liegt aber wohl in alten Winzertraditionen und traditioneller Vergärung, durch die Pierre Clavel seine Erzeugnisse gewinnt. Die Winzertradition beinhaltet eine Vergärung in Betonbehältern. Diese "alte" Vergärungsart wird wieder modern und liefert schmackhafte sowie rassige Weinerzeugnisse. Die fruchtige Note der Rasseweine des Weingutes Domaine Clavel begeistert Weinkenner. Pierre Clavel stellte 2005 seine Anbauweise auf biologische, organische Produktion um. Den Copa Santa stellte der Winzer sogar auf biodynamische Produktion um. Seit 2009 tragen seine Erzeugnisse auch das "Organic"-Zertifikat.

Domaine Clavel - fruchtige und rassige Weine

Pierre Clavel produziert fruchtige Einstiegsweine wie den Mas Clavel, der ein sehr gutes Preis-Leistungsverhältnis aufweist. Unschlagbar ist der Wein Les Garrigues, der von Pierre Clavel selbst Cuvee Gourmande genannt wird und ein "Riese" unter den Weinen ist. Letzterer ist ein Bio-Rotwein und von ECOCERT zertifiziert. Der Les Garrigues wird 14 Monate in Betontanks gereift und erhält während der Reifung seinen lebendigen, vollmundigen, fruchtigen und leicht süßen Geschmack. Die würzige Süße wird durch Zimt und Nelken hervorgerufen. Wie die meisten Rotweine sollte auch der Les Garrigues vor dem Servieren atmen (mind. 30 Minuten).

Domaine Clavel - Philosophie

Pierre Clavel möchte mit seinen Weinen sowohl Weinkenner als auch Laien begeistern. So sollen seine Weine versöhnen, freundlich stimmen und Geist sowie Körper stimulieren. Das sind nur einige der Elemente, die Pierre Clavels Philosophie beinhaltet. Der Winzer möchte den Menschen mit seiner Geschichte und seinen Weinen Hoffnung, Vergnügen, Befriedigung und natürlich auch Sinnlichkeit bescheren. Die Weine von Domaine Clavel bringen Menschen zusammen und sorgen für außergewöhnliche und vor allem schmackhafte Momente.

Informationen zum Shop von Weinladen Schmidt