arrowawardbinbottlebottlescartcheck_green_xlcheckeditfacebookfiltergoogle leafminusplusportal-backportal-cartportal-closeportal-credit-carteportal-emailportal-filter-navigation-openportal-filter-navigationportal-helpportal-homepage-01portal-homepage-02portal-homepage-03portal-homepage-04portal-homepage-05portal-loginportal-navigation-openportal-navigationpayment-billportal-searchportal-vinegrower-surfaceportal-vinegrowersavespiketimetrianglewarning
Logo von Becker - Das Weingut
  • Marco Becker

  • Deutschland / Rheinhessen

  • 20,0 Hektar

  • Versand- und Zahlungsinformationen

Datenschutzerklärung von Becker - Das Weingut

  Die Nutzung unserer Seite ist ohne eine Angabe von personenbezogenen Daten möglich. Für die Nutzung einzelner Services unserer Seite können sich hierfür abweichende Regelungen ergeben, die in diesem Falle nachstehend gesondert erläutert werden. Ihre personenbezogenen Daten (z.B. Name, Anschrift, E-Mail, Telefonnummer, u.ä.) werden von uns nur gemäß den Bestimmungen des deutschen Datenschutzrechts verarbeitet. Daten sind dann personenbezogen, wenn sie eindeutig einer bestimmten natürlichen Person zugeordnet werden können. Die rechtlichen Grundlagen des Datenschutzes finden Sie im Bundesdatenschutzgesetz (BDSG) und dem Telemediengesetz (TMG). Nachstehende Regelungen informieren Sie insoweit über die Art, den Umfang und Zweck der Erhebung, die Nutzung und die Verarbeitung von personenbezogenen Daten durch den Anbieter
[Marco Becker]
[Tel : 06136 / 42270]
Wir weisen darauf hin, dass die internetbasierte Datenübertragung Sicherheitslücken aufweist, ein lückenloser Schutz vor Zugriffen durch Dritte somit unmöglich ist.


Wir verwenden auf unserer Seite sog. Cookies zum Wiedererkennen mehrfacher Nutzung unseres Angebots, durch denselben Nutzer/Internetanschlussinhaber. Cookies sind kleine Textdateien, die Ihr Internet-Browser auf Ihrem Rechner ablegt und speichert. Sie dienen dazu, unseren Internetauftritt und unsere Angebote zu optimieren. Es handelt sich dabei zumeist um sog. "Session-Cookies", die nach dem Ende Ihres Besuches wieder gelöscht werden.
Teilweise geben diese Cookies jedoch Informationen ab, um Sie automatisch wieder zu erkennen. Diese Wiedererkennung erfolgt aufgrund der in den Cookies gespeicherten IP-Adresse. Die so erlangten Informationen dienen dazu, unsere Angebote zu optimieren und Ihnen einen leichteren Zugang auf unsere Seite zu ermöglichen.
Sie können die Installation der Cookies durch eine entsprechende Einstellung Ihres Browsers verhindern; wir weisen Sie jedoch darauf hin, dass Sie in diesem Fall gegebenenfalls nicht sämtliche Funktionen unserer Website vollumfänglich nutzen können.

Einsatz von Google-Analytics mit Anonymisierungsfunktion

Wir setzen auf unserer Seite Google-Analytics, einen Webanalysedienst der Firma Google Inc., 1600 Amphitheatre Parkway, Mountain View, CA 94043 USA, nachfolgend „Google“ ein. Google-Analytics verwendet sog. „Cookies“, Textdateien, die auf Ihrem Computer gespeichert werden und hierdurch eine Analyse der Benutzung der Website durch Sie ermöglichen.
Die durch diese Cookies erzeugten Informationen, beispielsweise Zeit, Ort und Häufigkeit Ihres Webseiten-Besuchs einschließlich Ihrer IP-Adresse, werden an Google in den USA übertragen und dort gespeichert.
Wir verwenden auf unserer Website Google-Analytics mit dem Zusatz "_gat._anonymizeIp". Ihre IP-Adresse wird in diesem Fall von Google schon innerhalb von Mitgliedstaaten der Europäischen Union oder in anderen Vertragsstaaten des Abkommens über den Europäischen Wirtschaftsraum gekürzt und dadurch anonymisiert.
Google wird diese Informationen benutzen, um Ihre Nutzung unserer Seite auszuwerten, um Reports über die Websiteaktivitäten für uns zusammenzustellen und um weitere mit der Websitenutzung und der Internetnutzung verbundene Dienstleistungen zu erbringen. Auch wird Google diese Informationen gegebenenfalls an Dritte übertragen, sofern dies gesetzlich vorgeschrieben oder soweit Dritte diese Daten im Auftrag von Google verarbeiten. 
Google wird, nach eigenen Angaben, in keinem Fall Ihre IP-Adresse mit anderen Daten von Google in Verbindung bringen. Sie können die Installation der Cookies durch eine entsprechende Einstellung Ihrer Browser-Software verhindern; wir weisen Sie jedoch darauf hin, dass Sie in diesem Fall gegebenenfalls nicht sämtliche Funktionen unserer Website vollumfänglich nutzen können.
Des Weiteren bietet Google für die gängigsten Browser ein Deaktivierungs-Add-on an, welches Ihnen mehr Kontrolle darüber gibt, welche Daten von Google zu der von Ihnen aufgerufenen Websites erfasst werden. Das Add-on teilt dem JavaScript (ga.js) von Google Analytics mit, dass keine Informationen zum Website-Besuch an Google Analytics übermittelt werden sollen. Das Deaktivierungs-Add-on für Browser von Google Analytics verhindert aber nicht, dass Informationen an uns oder an andere von uns gegebenenfalls eingesetzte Webanalyse-Services übermittelt werden. Weitere Informationen zur Installation des Browser Add-on erhalten Sie über nachfolgenden Link:

Einsatz von facebook-Komponenten
Wir setzen auf unserer Seite Komponenten des Anbieters ein. Facebook ist ein Service der facebook Inc., 1601 S. California Ave, Palo Alto, CA 94304, USA.
Bei jedem einzelnen Abruf unserer Webseite, die mit einer solchen Komponente ausgestattet ist, veranlasst diese Komponente, dass der von Ihnen verwendete Browser eine entsprechende Darstellung der Komponente von facebook herunterlädt. Durch diesen Vorgang wird facebook darüber in Kenntnis gesetzt, welche konkrete Seite unserer Internetpräsenz gerade durch Sie besucht wird.
Wenn Sie unsere Seite aufrufen und währenddessen bei facebook eingeloggt sind, erkennt facebook durch die von der Komponente gesammelte Information, welche konkrete Seite Sie besuchen und ordnet diese Informationen Ihrem persönlichen Account auf facebook zu. Klicken Sie z.B. den  „Gefällt mir“-Button an oder geben Sie entsprechende Kommentare ab, werden diese Informationen an Ihr persönliches Benutzerkonto auf facebook übermittelt und dort gespeichert. Darüber hinaus wird die Information, dass Sie unsere Seite besucht haben, an facebook weiter gegeben. Dies geschieht unabhängig davon, ob Sie die Komponente anklicken oder nicht.
Wenn Sie diese Übermittlung und Speicherung von Daten über Sie und Ihr Verhalten auf unserer Webseite durch facebook unterbinden wollen, müssen Sie sich bei facebook ausloggen und zwar bevor Sie unsere Seite besuchen. Die Datenschutzhinweise von facebook geben hierzu nähere Informationen, insbesondere zur Erhebung und Nutzung der Daten durch facebook, zu Ihren diesbezüglichen Rechten sowie zu den Einstellungsmöglichkeiten zum Schutz Ihrer Privatsphäre:
Zudem sind am Markt externe Tools erhältlich, mit denen Facebook-Social-Plugins mit Add-ons für alle gängigen Browser blockiert werden können
Eine Übersicht über die Facebook-Plugins finden Sie unter

Einsatz von Google-Adwords

Wir setzen zur Bewerbung unserer Website ferner das Google Werbetool "Google-Adwords" ein. Im Rahmen dessen verwenden wir auf unserer Website den Analysedienst "Conversion-Tracking" der Firma Google Inc., 1600 Amphitheatre Parkway, Mountain View, CA 94043 USA, nachfolgend „Google“. Sofern Sie über eine Google-Anzeige auf unsere Webseite gelangt sind, wird ein Cookie auf Ihrem Rechner abgelegt. Cookies sind kleine Textdateien, die Ihr Internet-Browser auf Ihrem Rechner ablegt und speichert. Diese sog. "Conversion- Cookies" verlieren nach 30 Tagen ihre Gültigkeit und dienen nicht Ihrer persönlichen Identifikation. Besuchen Sie bestimmte Seiten unserer Website und das Cookie ist noch nicht abgelaufen, können wir und Google erkennen, dass Sie als Nutzer auf eine unserer bei Google platzierten Anzeigen geklickt haben und zu unserer Seite weitergeleitet wurden.
Die mit Hilfe der "Conversion-Cookies" eingeholten Informationen dienen Google dazu, Besuchs-Statistiken für unsere Website zu erstellen. Wir erfahren durch diese Statistik die Gesamtanzahl der Nutzer, die auf unsere Anzeige geklickt haben und zudem welche Seiten unserer Website vom jeweiligen Nutzer im Anschluss aufgerufen wurden. Wir bzw. andere über "Google-Adwords" Werbende erhalten jedoch keinerlei Informationen, mit denen sich Nutzer persönlich identifizieren lassen.
Sie können die Installation der "Conversion-Cookies" durch eine entsprechende Einstellung Ihres Browsers verhindern, etwa per Browser-Einstellung, die das automatische Setzen von Cookies generell deaktiviert oder speziell nur die Cookies von der Domain "“ blockiert.
Die diesbezügliche Datenschutzerklärung von Google erhalten Sie unter nachfolgendem Link:

Weitergabe der Daten an Dritte

Wir verwenden Ihre Bestandsdaten ausschließlich zur Abwicklung Ihrer Bestellung. Wir geben Ihre personenbezogenen Daten einschließlich Ihrer Haus-Adresse und E-Mail-Adresse nicht ohne Ihre ausdrückliche und jederzeit widerrufliche Einwilligung an Dritte weiter. Ausgenommen hiervon sind unsere Dienstleistungspartner, die zur Bestellabwicklung die Übermittlung von Daten benötigen (z.B. das mit der Lieferung beauftragte Versandunternehmen und das mit der Zahlungsabwicklung beauftragte Kreditinstitut). In diesen Fällen beschränkt sich der Umfang der übermittelten Daten jedoch nur auf das erforderliche Minimum. Ihre schutzwürdigen Belange werden gemäß den gesetzlichen Bestimmungen berücksichtigt.


Sie können sich aufgrund des Bundesdatenschutzgesetzes bei Fragen zur Erhebung, Verarbeitung oder Nutzung Ihrer personenbezogenen Daten und deren Berichtigung, Sperrung, Löschung oder einem Widerruf einer erteilten Einwilligung unentgeltlich an uns wenden. Wir weisen darauf hin, dass Ihnen ein Recht auf Berichtigung falscher Daten oder Löschung personenbezogener Daten zusteht, sollte diesem Anspruch keine gesetzliche Aufbewahrungspflicht entgegenstehen.